PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.307270.1
Common NameWRKY24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 343aa    MW: 38199.8 Da    PI: 9.0551
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.307270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.2e-3376132360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+kv ei+Y+geHnh+k
  Cucsa.307270.1  76 DGYNWRKYGQKQVKGSEYPRSYYKCTHPSCPVKKKVERSL-DGKVAEIVYKGEHNHPK 132
                     9***************************************.***************85 PP

2WRKY89.43e-28273327458
                     SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   4 gynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     g +WrKYGqK+vkg+ +prsYYrCt  +C+++k ver++edp+ +++tYeg+Hnh
  Cucsa.307270.1 273 GVRWRKYGQKVVKGNLYPRSYYRCTGLKCKARKYVERASEDPDSFITTYEGKHNH 327
                     679**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.0E-3068133IPR003657WRKY domain
PROSITE profilePS5081124.5769133IPR003657WRKY domain
SuperFamilySSF1182903.4E-2671133IPR003657WRKY domain
SMARTSM007741.0E-3674132IPR003657WRKY domain
PfamPF031061.7E-2576131IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-27258328IPR003657WRKY domain
PROSITE profilePS5081128.908265330IPR003657WRKY domain
SuperFamilySSF1182909.94E-25268328IPR003657WRKY domain
SMARTSM007746.9E-29270329IPR003657WRKY domain
PfamPF031067.1E-23273327IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MDNKATERVV IARPVASRPT CSSFKSFSDI LTCAFDTSPP NMSSETRVAA IRPKTVSKKD  60
PTLLRPQISG AQPSYDGYNW RKYGQKQVKG SEYPRSYYKC THPSCPVKKK VERSLDGKVA  120
EIVYKGEHNH PKPQPLKQNS SGTQREGSIS NGTTQDTNPE LWFNYLNGRI EGCESRIENH  180
IEKTCQDRVT IPFDPFSNQE VNARCGISDN NSCGLSVECE EGSKGLQSMD DKLRSKRRGG  240
KNPTNEGETL IEGVNEHHAM AQDSTGIEIS GKGVRWRKYG QKVVKGNLYP RSYYRCTGLK  300
CKARKYVERA SEDPDSFITT YEGKHNHGIS LGTSISVAPE ME*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2376329877Probable WRKY transcription factor 4
2lex_A4e-2376329877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840230.0GU984023.1 Cucumis sativus WRKY protein (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267637.10.0WRKY transcription factor 44-like
RefseqXP_011650226.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
SwissprotQ9ZUU03e-72WRK44_ARATH; WRKY transcription factor 44
TrEMBLE7CEX20.0E7CEX2_CUCSA; WRKY protein
STRINGVIT_08s0040g03070.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.24e-74WRKY family protein
Publications ? help Back to Top
  1. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]